PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_011082685.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Pedaliaceae; Sesamum
Family GeBP
Protein Properties Length: 361aa    MW: 40552.6 Da    PI: 9.4073
Description GeBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_011082685.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF573113.21.7e-35150244296
          DUF573   2 lfqrlwseeDeivlLqGlidfkaktgkspsddidafyefvkksisfkvsksqlveKirrLKkKfkkkvkkaksgkepsfskehdqkifelskkiW 96 
                     lfqr+wse+Deiv+LqG+id+ +k++++p++d++af++f+kk+++++v +sql +KirrL+ ++++++ k k+gke  fsk h+q+++elskkiW
  XP_011082685.1 150 LFQRVWSEDDEIVILQGMIDYVTKKKSDPVADLNAFHDFIKKNLQADVIRSQLQDKIRRLRLRYENNKGKEKEGKERIFSKRHEQNVYELSKKIW 244
                     69********************************************************************************************* PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF045042.9E-31151244IPR007592Protein of unknown function DUF573
Sequence ? help Back to Top
Protein Sequence    Length: 361 aa     Download sequence    Send to blast
MAKNREPEKP MESGKEEGHQ ATSEDAGSQD SDSAPHLAQV SKKPSSSTLA TPKKAKPQSS  60
SKPQTQPPSS SDEEKSGSES ESDSDEPDPN VKPSSDGARK LKSKAIASDL VTPAKSTAAK  120
RPAEEKETNT KDAKKLKKKA EPETSEKKLL FQRVWSEDDE IVILQGMIDY VTKKKSDPVA  180
DLNAFHDFIK KNLQADVIRS QLQDKIRRLR LRYENNKGKE KEGKERIFSK RHEQNVYELS  240
KKIWWNESGK ENGVEKVMGN GSALRKIPSK RPYTVENEFL EFVNSDLERL LPAKRVNSGG  300
VTVEERILMI GAEYYESGKG LEEEKEWKKL NVEEMEVYLR QLEVKTARAK LVLDAVKSGG  360
H
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011082685.10.0PREDICTED: mediator-associated protein 1-like
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA30421947
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G00390.16e-24DNA-binding storekeeper protein-related transcriptional regulator